Bizator  /  Adverts  /  agriculture  /  cattle breeding
Sort by: 
Show: 2040100
The antifungal shampoo with pyrocoelia prolonged action for dogs and cats-gr.
sale
Soft antifungal shampoo is used for surface and deep dermatitis, tinea, trihofitii, seborrhea and other skin diseases of animals, to prevent them. The shampoo cleanses the hair and skin without disturbing the
Ukraine, Kyiv Oblast', Kyiv
Show phone
Processing rooms poultry and incubators ozone
services
We offer disposable disinfection of incubators and poultry ozone. Disinfection is performed by means of high-tech equipment series StreamOzone Agro. You will receive a range of services aimed at the complete destruction
Ukraine, Kharkivs'ka Oblast', Kharkiv
Tar (beech resin)
sale
100% natural product of pyrolysis Applies -in pharmaceutics and cosmetology antiseptic,based ointments, additive shampoos, Soaps. -animal health - product hoof care,protects against moisture and bacteria, prevents
Ukraine, Zakarpattia Oblast, Perechyn
Show phone
Gel "STRONG TEETH" -GM(.for treatment of the gums of dogs and cats),25ml.
sale
Gel assign appropriate animal for hygienic treatment of the oral cavity, decrease pain and improve the condition of the mucous membrane Rotova Gel "Strong teeth" for the treatment of gum disease in dogs and
Ukraine, Kyiv Oblast', Kyiv
Show phone
Propanol kurjata broiler, ducklings, goslings Ukraine
sale
Agro-industrial company "Astra" offers for sale (at factory price) one-day and multi-age chickens broilers (ROSS 308 ) meat-aeco breed "Rebro" , "Tetha H" , "Super Harco" (Hungary) . Ducklings Belarusian selection
Ukraine, Chernihivs'ka Oblast', Chernihiv
Show phone
Show phone
Oxalacetic strips. (10 half-up. ). Agrobiorama. Russia.-30.
sale
Oxalacetic Paper plate size 150 x 25 x 2.5 mm containing in its composition effective antibiotics and excipients. OXALACETIC - strips ® for the treatment and prevention of GYLCOLIC DISEASES of bees. The release
Ukraine, Kyiv Oblast', Kyiv
Show phone
Industrial air cooling.Cooling farms
sale
THE COOLING APPARATUS BREEZAIR INDUSTRIAL EVAPORATIVE TYPE OF PRODUCTION AUSTRALIA. The performance of the individual units from 6000 to 33,000 cubic meters of refrigerated air per hour. The energy consumption in
Ukraine, Vinnytsia Oblast', Vinnytsya
Show phone
Feed, feed additives
sale
Internet-shop "MotoDnepr" offers food for animals and birds with a high content of minerals, vitamins, protein, does not contain hormones and various stimulants. In feed contains vegetable raw materials (wheat,
Ukraine, Dnipropetrovska Oblast', Dnipropetrovsk
Show phone
Show phone
Show phone
Show phone
Feed, thermotransport and suction equipment
sale
The company Dose-agro produces: -Feed mills series "Dose" is intended for comprehensive preparation for powder and granulated feed. The plant feed allows in terms of agricultural enterprises to produce a
Russian Federation, Krasnodarskiy Kray, Krasnodar
Show phone
Sell Flour hrusak (meal worm) Tenebrio molitor
sale
Flour hrusak (meal worm) Tenebrio molitor Type Arthropods (Arthropoda), the class of True insects (Insecta - Ectognatha), Coleoptera, or Beetles (Coleoptera) family of Chernotsky (Tenebrionidae). The cosmopolitan.
Ukraine, Dnipropetrovska Oblast', Dnipropetrovsk
Show phone
Show phone
Will sell Zophobas (Zophobas morio)
sale
Larvae zophobas morio Zophobas (Zophobas morio) Type Arthropods (Arthropoda), the class of True insects (Insecta, Coleoptera, or Beetles (Coleoptera) family of Chernotsky (Tenebrionidae). This species is
Ukraine, Dnipropetrovska Oblast', Dnipropetrovsk
Show phone
Show phone
the production base of agricultural
sale
Two buildings with area of 1800 sq. m., the presence of granary, a room under the hatchery, the new water tower, electrical substation at 80 KW, an artesian well. All of the objects are located on a land plot
Russian Federation
Show phone
The packages of bees spring 2013, the price of 600 UAH./PCs
sale
Engaged in beekeeping for over 30 years. At the moment our apiary consists of 110 bee colonies. Breed bees - Ukrainian steppe (Apis mellifra acervorum Scor.). Our bees productively use the honey from acacia,
Ukraine, Kharkivs'ka Oblast', Kharkiv
Show phone
Lipol-T (amitraz, thymol) 10 strips-up. -Gr.
sale
Lipol-T (Laminae Amipol-T) Has virginiamedicalmalpracticelawyer forms Varroajacobsoni. The composition and form of issue: Strips with veneer size 200x20x1 mm, impregnated with a solution of amitraz and thymol.
Ukraine, Kyiv Oblast', Kyiv
Show phone
Pork sides wholesale directly from factory
sale
Pork meat in carcasses in bulk directly from the manufacturer (Russia and Belarus). 1, 2, 3 category, GOST, a full package of documents. Shipping to the Russian Federation. The minimum volume of 16 tons. In
Show phone
Beef sides wholesale with slaughterhouse
sale
Meat beef carcasses in bulk directly from the manufacturer (Russia and Belarus). 1 category, GOST, a full package of documents. Shipping to the Russian Federation. The minimum volume of 16 tons. In some cases,
Show phone
Supplementary fish fodder
sale
Supplermentary fish fodder. General protein from 64% to 80%. Component for feed mix. Composition: fish meal,poultry meal,feather meal,fodder chalk,detoxification agent.
Show phone
linseed cake / linseed oil
sale
Company Systema LLC is one of the main producers and exporters of the linseed and soya and sunflower oil and cake in Ukraine. We are working effective on the Ukrainian and EC market more the 10 years. We
Ukraine
Show phone