Sort by:
Date
Show: 2040100
sale
Oxalacetic Paper plate size 150 x 25 x 2.5 mm containing in its composition effective antibiotics and excipients. OXALACETIC - strips ® for the treatment and prevention of GYLCOLIC DISEASES of bees. The release
Ukraine, Kyiv Oblast', Kyiv
0973134792
Show phone
sale
THE COOLING APPARATUS BREEZAIR INDUSTRIAL EVAPORATIVE TYPE OF PRODUCTION AUSTRALIA. The performance of the individual units from 6000 to 33,000 cubic meters of refrigerated air per hour. The energy consumption in
Ukraine, Vinnytsia Oblast', Vinnytsya
0972838643;0991112270;
Show phone
sale
Internet-shop "MotoDnepr" offers food for animals and birds with a high content of minerals, vitamins, protein, does not contain hormones and various stimulants. In feed contains vegetable raw materials (wheat,
Ukraine, Dnipropetrovska Oblast', Dnipropetrovsk
sale
The company Dose-agro produces: -Feed mills series "Dose" is intended for comprehensive preparation for powder and granulated feed. The plant feed allows in terms of agricultural enterprises to produce a
Russian Federation, Krasnodarskiy Kray, Krasnodar
8-905-660-72-12
Show phone
sale
Larvae zophobas morio Zophobas (Zophobas morio) Type Arthropods (Arthropoda), the class of True insects (Insecta, Coleoptera, or Beetles (Coleoptera) family of Chernotsky (Tenebrionidae). This species is
Ukraine, Dnipropetrovska Oblast', Dnipropetrovsk
099 971 44 42
Show phone 096 937 45 04
Show phone
sale
Flour hrusak (meal worm) Tenebrio molitor Type Arthropods (Arthropoda), the class of True insects (Insecta - Ectognatha), Coleoptera, or Beetles (Coleoptera) family of Chernotsky (Tenebrionidae). The cosmopolitan.
Ukraine, Dnipropetrovska Oblast', Dnipropetrovsk
099 971 44 42
Show phone 096 937 45 04
Show phone
sale
Two buildings with area of 1800 sq. m., the presence of granary, a room under the hatchery, the new water tower, electrical substation at 80 KW, an artesian well. All of the objects are located on a land plot
Russian Federation
9184382379
Show phone
sale
Engaged in beekeeping for over 30 years. At the moment our apiary consists of 110 bee colonies. Breed bees - Ukrainian steppe (Apis mellifra acervorum Scor.). Our bees productively use the honey from acacia,
Ukraine, Kharkivs'ka Oblast', Kharkiv
066-48-46-028
Show phone
sale
Lipol-T (Laminae Amipol-T) Has virginiamedicalmalpracticelawyer forms Varroajacobsoni. The composition and form of issue: Strips with veneer size 200x20x1 mm, impregnated with a solution of amitraz and thymol.
Ukraine, Kyiv Oblast', Kyiv
0973134792
Show phone
sale
Pork meat in carcasses in bulk directly from the manufacturer (Russia and Belarus). 1, 2, 3 category, GOST, a full package of documents. Shipping to the Russian Federation. The minimum volume of 16 tons. In
8 (965) 292-35-37
Show phone
sale
Meat beef carcasses in bulk directly from the manufacturer (Russia and Belarus). 1 category, GOST, a full package of documents. Shipping to the Russian Federation. The minimum volume of 16 tons. In some cases,
8 (965) 292-35-37
Show phonesale
Supplermentary fish fodder. General protein from 64% to 80%. Component for feed mix. Composition: fish meal,poultry meal,feather meal,fodder chalk,detoxification agent.
+48 783 444 129
Show phonesale
Company Systema LLC is one of the main producers and exporters of the linseed and soya and sunflower oil and cake in Ukraine. We are working effective on the Ukrainian and EC market more the 10 years. We
Ukraine
+380675694257
Show phone
